Recombinant Human C11orf46 Protein, GST-tagged
| Cat.No. : | C11orf46-468H |
| Product Overview : | Human C11orf46 full-length ORF ( NP_689529.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 55.7 kDa |
| AA Sequence : | MMDPCSVGVQLRTTNECHKTYYTRHTGFKTLQELSSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKKLAKKNLHVIDLDDATFLSAKFGRQLVPGWKLCPKCTQIINGSVDVDTEDRQKRKPESDGRTAKALRSLQFTNPGRQTEFAPETGKREKRRLTKNATAGSDRQVIPAKSKVYDSQGLLIFSGMDLCDCLDEDCLGCFYACPACGSTKCGAECRCDRKWLYEQIEIEGGEIIHNKHAG |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C11orf46 chromosome 11 open reading frame 46 [ Homo sapiens ] |
| Official Symbol | C11orf46 |
| Synonyms | C11ORF46; chromosome 11 open reading frame 46; ARF7 effector protein; FLJ38968; uncharacterized protein C11orf46; ARF7EP; dJ299F11.1; |
| Gene ID | 120534 |
| mRNA Refseq | NM_152316 |
| Protein Refseq | NP_689529 |
| MIM | 612295 |
| UniProt ID | Q8N8R7 |
| ◆ Recombinant Proteins | ||
| C11orf46-468H | Recombinant Human C11orf46 Protein, GST-tagged | +Inquiry |
| C11orf46-1821HF | Recombinant Full Length Human C11orf46 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C11orf46-8351HCL | Recombinant Human C11orf46 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C11orf46 Products
Required fields are marked with *
My Review for All C11orf46 Products
Required fields are marked with *
