Recombinant Full Length Human C11orf88 Protein, GST-tagged
Cat.No. : | C11orf88-4941HF |
Product Overview : | Human FLJ46266 full-length ORF ( NP_997313.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 178 amino acids |
Description : | C11orf88 (Chromosome 11 Open Reading Frame 88) is a Protein Coding gene. |
Molecular Mass : | 46.8 kDa |
AA Sequence : | METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDSSQRLPVARPRRSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKTRSHSVTQNEVQWHDHGSLQPQLSRIQAKTREEILQLLRKQREERISKELISLPYKPKAKEHKAE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C11orf88 chromosome 11 open reading frame 88 [ Homo sapiens (human) ] |
Official Symbol | C11orf88 |
Synonyms | C11orf88; chromosome 11 open reading frame 88; UPF0722 protein C11orf88; hypothetical gene supported by BC039505 |
Gene ID | 399949 |
mRNA Refseq | NM_001100388 |
Protein Refseq | NP_001093858 |
UniProt ID | Q6PI97 |
◆ Recombinant Proteins | ||
C11orf88-4354H | Recombinant Human C11orf88 Protein, GST-tagged | +Inquiry |
C11orf88-4941HF | Recombinant Full Length Human C11orf88 Protein, GST-tagged | +Inquiry |
C11orf88-1274H | Recombinant Human C11orf88 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C11orf88 Products
Required fields are marked with *
My Review for All C11orf88 Products
Required fields are marked with *