Recombinant Human C11orf88 Protein, GST-tagged

Cat.No. : C11orf88-4354H
Product Overview : Human FLJ46266 full-length ORF ( NP_997313.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C11orf88 (Chromosome 11 Open Reading Frame 88) is a Protein Coding gene.
Molecular Mass : 46.8 kDa
AA Sequence : METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDSSQRLPVARPRRSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKTRSHSVTQNEVQWHDHGSLQPQLSRIQAKTREEILQLLRKQREERISKELISLPYKPKAKEHKAE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C11orf88 chromosome 11 open reading frame 88 [ Homo sapiens (human) ]
Official Symbol C11orf88
Synonyms C11orf88; chromosome 11 open reading frame 88; UPF0722 protein C11orf88; hypothetical gene supported by BC039505
Gene ID 399949
mRNA Refseq NM_001100388
Protein Refseq NP_001093858
UniProt ID Q6PI97

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C11orf88 Products

Required fields are marked with *

My Review for All C11orf88 Products

Required fields are marked with *

0
cart-icon
0
compare icon