Recombinant Human C11orf88 Protein, GST-tagged

• Cat.No.: C11orf88-4354H
• Product Overview: Human FLJ46266 full-length ORF ( NP_997313.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: C11orf88 (Chromosome 11 Open Reading Frame 88) is a Protein Coding gene.
• Molecular Mass: 46.8 kDa
• AA Sequence: METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDSSQRLPVARPRRSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKTRSHSVTQNEVQWHDHGSLQPQLSRIQAKTREEILQLLRKQREERISKELISLPYKPKAKEHKAE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C11orf88 chromosome 11 open reading frame 88 [ Homo sapiens (human) ]
• Official Symbol: C11orf88
• Synonyms: C11orf88; chromosome 11 open reading frame 88; UPF0722 protein C11orf88; hypothetical gene supported by BC039505
• Gene ID: 399949
• mRNA Refseq: NM_001100388
• Protein Refseq: NP_001093858
• UniProt ID: Q6PI97