Recombinant Full Length Human C12orf29 Protein, GST-tagged

Cat.No. : C12orf29-2022HF
Product Overview : Human C12orf29 full-length ORF (BAC04555.1, 1 a.a. - 325 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 325 amino acids
Description : Predicted to act upstream of or within hematopoietic progenitor cell differentiation.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 63.9 kDa
AA Sequence : MKRLGSVQRKMPCVFVTEVKEEPSSKREHQPFKVLATETVSHKALDADIYSAIPTEKVDGTCCYVTTYKDQPYLWARLDRKPNKQAEKRFKNFLHSKENPKEFFWNVEEDFKPAPECWIPAKETEQINGNPVPDENGHIPGWVPVEKNNKQYCWHSSVVNYEFEIALVLKHHPDDSGLLEISAVPLSDLLEQTLELIGTNINGNPYGLGSKKHPLHLLIPHGAFQIRNLPSLKHNDLLSWFEDCKEGKIEGIVWHCSDGCLIKVHRHHLGLCWPIPDTYMNSRPVIINMNLNKCDSAFDIKCLFNHFLKIDNQKFVRLKDIIFDV
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C12orf29 chromosome 12 open reading frame 29 [ Homo sapiens ]
Official Symbol C12orf29
Synonyms C12ORF29; chromosome 12 open reading frame 29; uncharacterized protein C12orf29; DKFZp434N2030; FLJ38158; MGC102978; DKFZp313K0436; DKFZp686L04169
Gene ID 91298
mRNA Refseq NM_001009894
Protein Refseq NP_001009894
UniProt ID Q8N999

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C12orf29 Products

Required fields are marked with *

My Review for All C12orf29 Products

Required fields are marked with *

0
cart-icon