Recombinant Full Length Human C12orf29 Protein, GST-tagged

• Cat.No.: C12orf29-2022HF
• Product Overview: Human C12orf29 full-length ORF (BAC04555.1, 1 a.a. - 325 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 325 amino acids
• Description: Predicted to act upstream of or within hematopoietic progenitor cell differentiation.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 63.9 kDa
• AA Sequence: MKRLGSVQRKMPCVFVTEVKEEPSSKREHQPFKVLATETVSHKALDADIYSAIPTEKVDGTCCYVTTYKDQPYLWARLDRKPNKQAEKRFKNFLHSKENPKEFFWNVEEDFKPAPECWIPAKETEQINGNPVPDENGHIPGWVPVEKNNKQYCWHSSVVNYEFEIALVLKHHPDDSGLLEISAVPLSDLLEQTLELIGTNINGNPYGLGSKKHPLHLLIPHGAFQIRNLPSLKHNDLLSWFEDCKEGKIEGIVWHCSDGCLIKVHRHHLGLCWPIPDTYMNSRPVIINMNLNKCDSAFDIKCLFNHFLKIDNQKFVRLKDIIFDV
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C12orf29 chromosome 12 open reading frame 29 [ Homo sapiens ]
• Official Symbol: C12orf29
• Synonyms: C12ORF29; chromosome 12 open reading frame 29; uncharacterized protein C12orf29; DKFZp434N2030; FLJ38158; MGC102978; DKFZp313K0436; DKFZp686L04169
• Gene ID: 91298
• mRNA Refseq: NM_001009894
• Protein Refseq: NP_001009894
• UniProt ID: Q8N999