Recombinant Human C12orf29 Protein, GST-tagged
Cat.No. : | C12orf29-496H |
Product Overview : | Human C12orf29 full-length ORF (BAC04555.1, 1 a.a. - 325 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 63.9 kDa |
AA Sequence : | MKRLGSVQRKMPCVFVTEVKEEPSSKREHQPFKVLATETVSHKALDADIYSAIPTEKVDGTCCYVTTYKDQPYLWARLDRKPNKQAEKRFKNFLHSKENPKEFFWNVEEDFKPAPECWIPAKETEQINGNPVPDENGHIPGWVPVEKNNKQYCWHSSVVNYEFEIALVLKHHPDDSGLLEISAVPLSDLLEQTLELIGTNINGNPYGLGSKKHPLHLLIPHGAFQIRNLPSLKHNDLLSWFEDCKEGKIEGIVWHCSDGCLIKVHRHHLGLCWPIPDTYMNSRPVIINMNLNKCDSAFDIKCLFNHFLKIDNQKFVRLKDIIFDV |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C12orf29 chromosome 12 open reading frame 29 [ Homo sapiens ] |
Official Symbol | C12orf29 |
Synonyms | C12ORF29; chromosome 12 open reading frame 29; uncharacterized protein C12orf29; DKFZp434N2030; FLJ38158; MGC102978; DKFZp313K0436; DKFZp686L04169; |
Gene ID | 91298 |
mRNA Refseq | NM_001009894 |
Protein Refseq | NP_001009894 |
UniProt ID | Q8N999 |
◆ Recombinant Proteins | ||
C12orf29-496H | Recombinant Human C12orf29 Protein, GST-tagged | +Inquiry |
C12orf29-2022HF | Recombinant Full Length Human C12orf29 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C12orf29-8324HCL | Recombinant Human C12orf29 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C12orf29 Products
Required fields are marked with *
My Review for All C12orf29 Products
Required fields are marked with *