Recombinant Full Length Human C1orf54 Protein, GST-tagged
Cat.No. : | C1orf54-4961HF |
Product Overview : | Human FLJ23221 full-length ORF ( AAH17761, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 131 amino acids |
Description : | C1orf54 (Chromosome 1 Open Reading Frame 54) is a Protein Coding gene. |
Molecular Mass : | 40.15 kDa |
AA Sequence : | MDVLFVAIFAVPLILGQEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C1orf54 chromosome 1 open reading frame 54 [ Homo sapiens ] |
Official Symbol | C1orf54 |
Synonyms | C1ORF54; chromosome 1 open reading frame 54; uncharacterized protein C1orf54; FLJ23221; |
Gene ID | 79630 |
mRNA Refseq | NM_024579 |
Protein Refseq | NP_078855 |
UniProt ID | Q8WWF1 |
◆ Recombinant Proteins | ||
C1orf54-4283H | Recombinant Human C1orf54 Protein, GST-tagged | +Inquiry |
C1ORF54-2187H | Recombinant Human C1ORF54 Protein (17-131 aa), His-B2M-tagged | +Inquiry |
C1orf54-4961HF | Recombinant Full Length Human C1orf54 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1orf54-639HCL | Recombinant Human C1orf54 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C1orf54 Products
Required fields are marked with *
My Review for All C1orf54 Products
Required fields are marked with *
0
Inquiry Basket