Recombinant Human C1ORF54 Protein (17-131 aa), His-B2M-tagged
| Cat.No. : | C1ORF54-2187H |
| Product Overview : | Recombinant Human C1ORF54 Protein (17-131 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 17-131 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 27.2 kDa |
| AA Sequence : | QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | C1orf54 chromosome 1 open reading frame 54 [ Homo sapiens ] |
| Official Symbol | C1ORF54 |
| Synonyms | C1ORF54; chromosome 1 open reading frame 54; uncharacterized protein C1orf54; FLJ23221; |
| Gene ID | 79630 |
| mRNA Refseq | NM_024579 |
| Protein Refseq | NP_078855 |
| UniProt ID | Q8WWF1 |
| ◆ Recombinant Proteins | ||
| C1ORF54-2187H | Recombinant Human C1ORF54 Protein (17-131 aa), His-B2M-tagged | +Inquiry |
| C1orf54-4961HF | Recombinant Full Length Human C1orf54 Protein, GST-tagged | +Inquiry |
| C1orf54-4283H | Recombinant Human C1orf54 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C1orf54-639HCL | Recombinant Human C1orf54 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1ORF54 Products
Required fields are marked with *
My Review for All C1ORF54 Products
Required fields are marked with *



