Recombinant Human C1ORF54 Protein (17-131 aa), His-B2M-tagged

• Cat.No.: C1ORF54-2187H
• Product Overview: Recombinant Human C1ORF54 Protein (17-131 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: E.coli
• Tag: B2M&His
• Protein Length: 17-131 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.2 kDa
• AA Sequence: QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: C1orf54 chromosome 1 open reading frame 54 [ Homo sapiens ]
• Official Symbol: C1ORF54
• Synonyms: C1ORF54; chromosome 1 open reading frame 54; uncharacterized protein C1orf54; FLJ23221
• Gene ID: 79630
• mRNA Refseq: NM_024579
• Protein Refseq: NP_078855
• UniProt ID: Q8WWF1