Recombinant Human C1ORF54 Protein (17-131 aa), His-B2M-tagged
Cat.No. : | C1ORF54-2187H |
Product Overview : | Recombinant Human C1ORF54 Protein (17-131 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 17-131 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 27.2 kDa |
AA Sequence : | QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | C1orf54 chromosome 1 open reading frame 54 [ Homo sapiens ] |
Official Symbol | C1ORF54 |
Synonyms | C1ORF54; chromosome 1 open reading frame 54; uncharacterized protein C1orf54; FLJ23221; |
Gene ID | 79630 |
mRNA Refseq | NM_024579 |
Protein Refseq | NP_078855 |
UniProt ID | Q8WWF1 |
◆ Recombinant Proteins | ||
C1orf54-4961HF | Recombinant Full Length Human C1orf54 Protein, GST-tagged | +Inquiry |
C1ORF54-2187H | Recombinant Human C1ORF54 Protein (17-131 aa), His-B2M-tagged | +Inquiry |
C1orf54-4283H | Recombinant Human C1orf54 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1orf54-639HCL | Recombinant Human C1orf54 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C1ORF54 Products
Required fields are marked with *
My Review for All C1ORF54 Products
Required fields are marked with *
0
Inquiry Basket