Recombinant Full Length Human C1QB Protein, C-Flag-tagged
Cat.No. : | C1QB-2136HFL |
Product Overview : | Recombinant Full Length Human C1QB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the B-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. C1q deficiency is associated with lupus erythematosus and glomerulonephritis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.5 kDa |
AA Sequence : | MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGD HGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTI RFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTG GMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Protein Pathways : | Complement and coagulation cascades, Prion diseases, Systemic lupus erythematosus |
Full Length : | Full L. |
Gene Name | C1QB complement C1q B chain [ Homo sapiens (human) ] |
Official Symbol | C1QB |
Synonyms | complement component 1, q subcomponent, B chain; complement component 1, q subcomponent, beta polypeptide; complement component C1q, B chain; complement subcomponent C1q chain B; OTTHUMP00000002940 |
Gene ID | 713 |
mRNA Refseq | NM_000491.5 |
Protein Refseq | NP_000482.3 |
MIM | 120570 |
UniProt ID | P02746 |
◆ Recombinant Proteins | ||
C1QB-1042R | Recombinant Rat C1QB Protein | +Inquiry |
C1QB-926Z | Recombinant Zebrafish C1QB | +Inquiry |
C1QB-596H | Recombinant Human C1QB protein(Met1-Ala253), His-tagged | +Inquiry |
C1QB-1132M | Recombinant Mouse C1QB Protein, His (Fc)-Avi-tagged | +Inquiry |
C1QB-2136HFL | Recombinant Full Length Human C1QB Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QB-651HCL | Recombinant Human C1QB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C1QB Products
Required fields are marked with *
My Review for All C1QB Products
Required fields are marked with *
0
Inquiry Basket