Recombinant Full Length Human C20orf203 Protein, GST-tagged

Cat.No. : C20orf203-5017HF
Product Overview : Human FLJ33706 full-length ORF (BAC03569.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 194 amino acids
Description : The protein encoded by this gene is thought to be a human-specific protein. Currently available evidence suggests that orthologous regions in other organisms contain sequence differences that would not support production of a protein product. Genome-wide association studies have suggested the possibility that a SNP in the 3' UTR, rs17123507, could be associated with nicotine addiction. Expression of this gene may be elevated in some individuals with Alzheimer's disease. [provided by RefSeq, Mar 2017]
Molecular Mass : 47.74 kDa
AA Sequence : MFPRPVLNSRAQAILLPQPPNMLDHRQWPPRLASFPFTKTGMLSRATSVLAGLTAHLWDLGGGAGRRTSKAQRVHPQPSHQRQPPPPQHPGPYQERIWVGGEGWGEVGGLRLSKVGRRDREVRRGLRAPAGRGRAMGGMPRMGTVGDFGQALSSLAWTSTCFQDFCLPSLPGKLPAPLISKQQFLSNSSRSLFN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C20orf203 chromosome 20 open reading frame 203 [ Homo sapiens (human) ]
Official Symbol C20orf203
Synonyms C20orf203; chromosome 20 open reading frame 203; uncharacterized protein C20orf203; alugen
Gene ID 284805
mRNA Refseq NM_182584
Protein Refseq NP_872390
UniProt ID Q8NBC4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C20orf203 Products

Required fields are marked with *

My Review for All C20orf203 Products

Required fields are marked with *

0
cart-icon