Recombinant Full Length Human C3orf35 Protein
Cat.No. : | C3orf35-2592HF |
Product Overview : | Human C3orf35 full-length ORF (ADR83466.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 170 amino acids |
Description : | C3orf35 (Chromosome 3 Open Reading Frame 35) is a Protein Coding gene. Diseases associated with C3orf35 include Muir-Torre Syndrome. |
Form : | Liquid |
Molecular Mass : | 13.1 kDa |
AA Sequence : | MKTMATRKRCKLSRTGPEFENVIKRLLCARTFHTRIGGDLTHGIINRGRRANAEQMGLQGSAQHFNIFPLDLWTQGDCMLVSLAKNKVNVFGAIINMAASVSGVIGGLKFSRTYYVKGI |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | C3orf35 chromosome 3 open reading frame 35 [ Homo sapiens (human) ] |
Official Symbol | C3orf35 |
Synonyms | C3orf35; chromosome 3 open reading frame 35; APRG1; AP20 region protein 1; AP20 region protein1; APRG1 tumor suppressor candidate; Chromosome 3 Open Reading Frame 35; APRG1 Tumor Suppressor Candidate; APRG1; AP20 Region Protein 1; AP20 Region Protein1; AP20 Region Protein |
Gene ID | 339883 |
mRNA Refseq | NM_001302831 |
Protein Refseq | NP_001289760 |
MIM | 611429 |
UniProt ID | Q8IVJ8 |
◆ Recombinant Proteins | ||
C3orf35-2592HF | Recombinant Full Length Human C3orf35 Protein | +Inquiry |
C3orf35-0028H | Recombinant Human C3orf35 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C3orf35 Products
Required fields are marked with *
My Review for All C3orf35 Products
Required fields are marked with *