Recombinant Human C3orf35 Protein

Cat.No. : C3orf35-0028H
Product Overview : Human C3orf35 full-length ORF (ADR83466.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : C3orf35 (Chromosome 3 Open Reading Frame 35) is a Protein Coding gene. Diseases associated with C3orf35 include Muir-Torre Syndrome.
Form : Liquid
Molecular Mass : 13.1 kDa
AA Sequence : MKTMATRKRCKLSRTGPEFENVIKRLLCARTFHTRIGGDLTHGIINRGRRANAEQMGLQGSAQHFNIFPLDLWTQGDCMLVSLAKNKVNVFGAIINMAASVSGVIGGLKFSRTYYVKGI
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name C3orf35 chromosome 3 open reading frame 35 [ Homo sapiens (human) ]
Official Symbol C3orf35
Synonyms C3orf35; chromosome 3 open reading frame 35; APRG1; AP20 region protein 1; AP20 region protein1; APRG1 tumor suppressor candidate; Chromosome 3 Open Reading Frame 35; APRG1 Tumor Suppressor Candidate; APRG1; AP20 Region Protein 1; AP20 Region Protein1; AP20 Region Protein
Gene ID 339883
mRNA Refseq NM_001302831
Protein Refseq NP_001289760
MIM 611429
UniProt ID Q8IVJ8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C3orf35 Products

Required fields are marked with *

My Review for All C3orf35 Products

Required fields are marked with *

0
cart-icon
0
compare icon