Recombinant Full Length Human C3orf36 Protein, GST-tagged

Cat.No. : C3orf36-2593HF
Product Overview : Human C3orf36 full-length ORF (NP_079317.2, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 165 amino acids
Description : C3orf36 (Chromosome 3 Open Reading Frame 36) is a Protein Coding gene.
Molecular Mass : 43.3 kDa
AA Sequence : MQAETILEGLEAGLPQAVSSGLSLVPAPGLVLTCLSAPSGPGGMALEPPPTTLRKAFLAQSTLLESTLEGAPEWAAPHPEEQRRSPPACSQHTPPLPSTPTGPPPCSPGGNHPLCALSGRGGGRCSIPSLSSSSTFSLFSSGCWNPRVKLRVRKSQSQGRAGQLI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C3orf36 chromosome 3 open reading frame 36 [ Homo sapiens (human) ]
Official Symbol C3orf36
Synonyms C3orf36; chromosome 3 open reading frame 36; uncharacterized protein C3orf36; Chromosome 3 Open Reading Frame 36
Gene ID 80111
mRNA Refseq NM_025041
Protein Refseq NP_079317
UniProt ID Q3SXR2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C3orf36 Products

Required fields are marked with *

My Review for All C3orf36 Products

Required fields are marked with *

0
cart-icon
0
compare icon