Recombinant Human C3orf36 Protein, GST-Tagged

• Cat.No.: C3orf36-0029H
• Product Overview: Human C3orf36 full-length ORF (NP_079317.2, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: C3orf36 (Chromosome 3 Open Reading Frame 36) is a Protein Coding gene.
• Molecular Mass: 43.3 kDa
• AA Sequence: MQAETILEGLEAGLPQAVSSGLSLVPAPGLVLTCLSAPSGPGGMALEPPPTTLRKAFLAQSTLLESTLEGAPEWAAPHPEEQRRSPPACSQHTPPLPSTPTGPPPCSPGGNHPLCALSGRGGGRCSIPSLSSSSTFSLFSSGCWNPRVKLRVRKSQSQGRAGQLI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C3orf36 chromosome 3 open reading frame 36 [ Homo sapiens (human) ]
• Official Symbol: C3orf36
• Synonyms: C3orf36; chromosome 3 open reading frame 36; uncharacterized protein C3orf36; Chromosome 3 Open Reading Frame 36
• Gene ID: 80111
• mRNA Refseq: NM_025041
• Protein Refseq: NP_079317
• UniProt ID: Q3SXR2