Recombinant Full Length Human C6orf48 Protein, GST-tagged

• Cat.No.: C6orf48-2706HF
• Product Overview: Human C6orf48 full-length ORF (AAH00706, 1 a.a. - 37 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C6orf48 (Chromosome 6 Open Reading Frame 48) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 29.7 kDa
• Protein Length: 37 amino acids
• AA Sequence: MRVVMARLLSEGEQGIPTACAAFAQQPAGGHVAAWLG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C6orf48 chromosome 6 open reading frame 48 [ Homo sapiens (human) ]
• Official Symbol: C6orf48
• Synonyms: C6orf48; chromosome 6 open reading frame 48; protein G8; Chromosome 6 Open Reading Frame 48; G8; Protein G8; D6S57
• Gene ID: 50854
• mRNA Refseq: NM_001040437
• Protein Refseq: NP_001035527
• MIM: 605447
• UniProt ID: Q9UBA6