Recombinant Full Length Human C6orf48 Protein, GST-tagged
Cat.No. : | C6orf48-2706HF |
Product Overview : | Human C6orf48 full-length ORF (AAH00706, 1 a.a. - 37 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
Description : | C6orf48 (Chromosome 6 Open Reading Frame 48) is a Protein Coding gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Molecular Mass : | 29.7 kDa |
Protein Length : | 37 amino acids |
AA Sequence : | MRVVMARLLSEGEQGIPTACAAFAQQPAGGHVAAWLG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name : | C6orf48 chromosome 6 open reading frame 48 [ Homo sapiens (human) ] |
Official Symbol : | C6orf48 |
Synonyms : | C6orf48; chromosome 6 open reading frame 48; protein G8; Chromosome 6 Open Reading Frame 48; G8; Protein G8; D6S57 |
Gene ID : | 50854 |
mRNA Refseq : | NM_001040437 |
Protein Refseq : | NP_001035527 |
MIM : | 605447 |
UniProt ID : | Q9UBA6 |
Products Types
◆ Recombinant Protein | ||
C6orf48-0123H | Recombinant Human C6orf48 Protein, GST-Tagged | +Inquiry |
◆ Lysates | ||
C6orf48-7981HCL | Recombinant Human C6orf48 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket