Recombinant Human C6orf48 Protein, GST-Tagged
Cat.No. : | C6orf48-0123H |
Product Overview : | Human C6orf48 full-length ORF (AAH00706, 1 a.a. - 37 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | C6orf48 (Chromosome 6 Open Reading Frame 48) is a Protein Coding gene. |
Molecular Mass : | 29.7 kDa |
AA Sequence : | MRVVMARLLSEGEQGIPTACAAFAQQPAGGHVAAWLG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C6orf48 chromosome 6 open reading frame 48 [ Homo sapiens (human) ] |
Official Symbol | C6orf48 |
Synonyms | C6orf48; chromosome 6 open reading frame 48; protein G8; Chromosome 6 Open Reading Frame 48; G8; Protein G8; D6S57 |
Gene ID | 50854 |
mRNA Refseq | NM_001040437 |
Protein Refseq | NP_001035527 |
MIM | 605447 |
UniProt ID | Q9UBA6 |
◆ Recombinant Proteins | ||
C6orf48-2706HF | Recombinant Full Length Human C6orf48 Protein, GST-tagged | +Inquiry |
C6orf48-0123H | Recombinant Human C6orf48 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C6orf48-7981HCL | Recombinant Human C6orf48 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C6orf48 Products
Required fields are marked with *
My Review for All C6orf48 Products
Required fields are marked with *