Recombinant Full Length Human C7orf33 Protein, GST-tagged

Cat.No. : C7orf33-2622HF
Product Overview : Human C7orf33 full-length ORF (NP_660347.1, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 177 amino acids
Description : C7orf33 (Chromosome 7 Open Reading Frame 33) is a Protein Coding gene.
Molecular Mass : 45.9 kDa
AA Sequence : MQVEVQSLSLEECPWRLPGPQCECEALLPSGARRRIDLRLSGRAVAVWVHVRGGPGQFNLSYATGRHKKPNPHQNMNRGMEFIAPVSAPTKSGAPWHFLSQGPTDAQRAVRIRPGTRMGLSSDPVVGTLSSSYLDLLTLSYKPGRTVTSSYLNVRGHEVRKLQNSVEATRISRTDSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C7orf33 chromosome 7 open reading frame 33 [ Homo sapiens (human) ]
Official Symbol C7orf33
Synonyms C7orf33; chromosome 7 open reading frame 33; uncharacterized protein C7orf33; Chromosome 7 Open Reading Frame 33
Gene ID 202865
mRNA Refseq NM_145304
Protein Refseq NP_660347
UniProt ID Q8WU49

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C7orf33 Products

Required fields are marked with *

My Review for All C7orf33 Products

Required fields are marked with *

0
cart-icon