Recombinant Human C7orf33 Protein, GST-Tagged
Cat.No. : | C7orf33-0142H |
Product Overview : | Human C7orf33 full-length ORF (NP_660347.1, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | C7orf33 (Chromosome 7 Open Reading Frame 33) is a Protein Coding gene. |
Molecular Mass : | 45.9 kDa |
AA Sequence : | MQVEVQSLSLEECPWRLPGPQCECEALLPSGARRRIDLRLSGRAVAVWVHVRGGPGQFNLSYATGRHKKPNPHQNMNRGMEFIAPVSAPTKSGAPWHFLSQGPTDAQRAVRIRPGTRMGLSSDPVVGTLSSSYLDLLTLSYKPGRTVTSSYLNVRGHEVRKLQNSVEATRISRTDSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C7orf33 chromosome 7 open reading frame 33 [ Homo sapiens (human) ] |
Official Symbol | C7orf33 |
Synonyms | C7orf33; chromosome 7 open reading frame 33; uncharacterized protein C7orf33; Chromosome 7 Open Reading Frame 33 |
Gene ID | 202865 |
mRNA Refseq | NM_145304 |
Protein Refseq | NP_660347 |
UniProt ID | Q8WU49 |
◆ Recombinant Proteins | ||
C7orf33-1851H | Recombinant Human C7orf33 Protein, His-tagged | +Inquiry |
C7orf33-2622HF | Recombinant Full Length Human C7orf33 Protein, GST-tagged | +Inquiry |
C7orf33-0142H | Recombinant Human C7orf33 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C7orf33 Products
Required fields are marked with *
My Review for All C7orf33 Products
Required fields are marked with *