Recombinant Full Length Human C7orf34 Protein, GST-tagged

Cat.No. : C7orf34-2623HF
Product Overview : Human C7orf34 full-length ORF (AAH14596.1, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 122 amino acids
Description : C7orf34 (Chromosome 7 Open Reading Frame 34) is a Protein Coding gene.
Molecular Mass : 39.82 kDa
AA Sequence : MPPLAPQLCRAVFLVPILLLLQVKPLNGSPGPKDGSQTEKTPSADQNQEQFEEHFVASSVGEMWQVVDMAQQEEDQSSKTAAVHKHSFHLSFCFSLASVMVFSGGPLRRTFPNIQLCFMLTH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C7orf34 chromosome 7 open reading frame 34 [ Homo sapiens ]
Official Symbol C7orf34
Synonyms ctm-1
Gene ID 135927
mRNA Refseq NM_178829
Protein Refseq NP_849151
MIM 618946
UniProt ID Q96L11

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C7orf34 Products

Required fields are marked with *

My Review for All C7orf34 Products

Required fields are marked with *

0
cart-icon
0
compare icon