Recombinant Full Length Human C8orf31 Protein, GST-tagged
| Cat.No. : | C8orf31-2637HF |
| Product Overview : | Human C8orf31 full-length ORF (BAC04358.1, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 132 amino acids |
| Description : | C8orf31 (Chromosome 8 Open Reading Frame 31) is a Protein Coding gene. |
| Molecular Mass : | 40.9 kDa |
| AA Sequence : | MAEKPHQNSCNSVRQLFKTKQLVTHRDRGSCTHRAQGLLAARTTALQRSPLQQEIWESTTALNLPSALAPQGLTAKDAHFLGDTDPIQEGARDHAAGGPFQDRQASVAAQTLSWERGQGFSRHHGNHLLYSH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C8orf31 chromosome 8 open reading frame 31 [ Homo sapiens (human) ] |
| Official Symbol | C8orf31 |
| Synonyms | C8orf31; chromosome 8 open reading frame 31; uncharacterized protein C8orf31; Chromosome 8 Open Reading Frame 31 |
| Gene ID | 286122 |
| mRNA Refseq | NM_173687 |
| Protein Refseq | NP_775958 |
| UniProt ID | Q8N9H6 |
| ◆ Recombinant Proteins | ||
| C8orf31-835H | Recombinant Human C8orf31 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| C8orf31-0159H | Recombinant Human C8orf31 Protein, GST-Tagged | +Inquiry |
| C8orf31-2637HF | Recombinant Full Length Human C8orf31 Protein, GST-tagged | +Inquiry |
| C8orf31-2048H | Recombinant Human C8orf31 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C8orf31 Products
Required fields are marked with *
My Review for All C8orf31 Products
Required fields are marked with *
