Recombinant Human C8orf31 Protein, GST-Tagged

Cat.No. : C8orf31-0159H
Product Overview : Human C8orf31 full-length ORF (BAC04358.1, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C8orf31 (Chromosome 8 Open Reading Frame 31) is a Protein Coding gene.
Molecular Mass : 40.9 kDa
AA Sequence : MAEKPHQNSCNSVRQLFKTKQLVTHRDRGSCTHRAQGLLAARTTALQRSPLQQEIWESTTALNLPSALAPQGLTAKDAHFLGDTDPIQEGARDHAAGGPFQDRQASVAAQTLSWERGQGFSRHHGNHLLYSH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C8orf31 chromosome 8 open reading frame 31 [ Homo sapiens (human) ]
Official Symbol C8orf31
Synonyms C8orf31; chromosome 8 open reading frame 31; uncharacterized protein C8orf31; Chromosome 8 Open Reading Frame 31
Gene ID 286122
mRNA Refseq NM_173687
Protein Refseq NP_775958
UniProt ID Q8N9H6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C8orf31 Products

Required fields are marked with *

My Review for All C8orf31 Products

Required fields are marked with *

0
cart-icon