Recombinant Full Length Human C9orf152 Protein, GST-tagged

• Cat.No.: C9orf152-2687HF
• Product Overview: Human C9orf152 full-length ORF (NP_001013011.1, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 218 amino acids
• Description: C9orf152 (Chromosome 9 Open Reading Frame 152) is a Protein Coding gene.
• Molecular Mass: 50.3 kDa
• AA Sequence: MAEGSRTQAPGKGPPLSIQFLRAQYEGLKRQQRTQAHLLVLPKGGNTPAPAESMVNAVWINKERRSSLSLEEADSEVEGRLEEAAQGCLQAPKSPWHTHLEMHCLVQTSPQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNLGLYGSA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C9orf152 chromosome 9 open reading frame 152 [ Homo sapiens ]
• Official Symbol: C9orf152
• Synonyms: C9ORF152; chromosome 9 open reading frame 152; uncharacterized protein C9orf152; bA470J20.2; MGC131682
• Gene ID: 401546
• mRNA Refseq: NM_001012993
• Protein Refseq: NP_001013011
• UniProt ID: Q5JTZ5