Recombinant Human C9orf152 Protein, GST-Tagged
| Cat.No. : | C9orf152-0188H |
| Product Overview : | Human C9orf152 full-length ORF (NP_001013011.1, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | C9orf152 (Chromosome 9 Open Reading Frame 152) is a Protein Coding gene. |
| Molecular Mass : | 50.3 kDa |
| AA Sequence : | MAEGSRTQAPGKGPPLSIQFLRAQYEGLKRQQRTQAHLLVLPKGGNTPAPAESMVNAVWINKERRSSLSLEEADSEVEGRLEEAAQGCLQAPKSPWHTHLEMHCLVQTSPQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNLGLYGSA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C9orf152 chromosome 9 open reading frame 152 [ Homo sapiens ] |
| Official Symbol | C9orf152 |
| Synonyms | C9ORF152; chromosome 9 open reading frame 152; uncharacterized protein C9orf152; bA470J20.2; MGC131682; |
| Gene ID | 401546 |
| mRNA Refseq | NM_001012993 |
| Protein Refseq | NP_001013011 |
| UniProt ID | Q5JTZ5 |
| ◆ Recombinant Proteins | ||
| C9orf152-1820HFL | Recombinant Full Length Human C9orf152 Protein, C-Flag-tagged | +Inquiry |
| C9orf152-0188H | Recombinant Human C9orf152 Protein, GST-Tagged | +Inquiry |
| C9orf152-2687HF | Recombinant Full Length Human C9orf152 Protein, GST-tagged | +Inquiry |
| C9orf152-477H | Recombinant Human C9orf152 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C9orf152-7941HCL | Recombinant Human C9orf152 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C9orf152 Products
Required fields are marked with *
My Review for All C9orf152 Products
Required fields are marked with *
