Recombinant Human C9orf152 Protein, GST-Tagged

Cat.No. : C9orf152-0188H
Product Overview : Human C9orf152 full-length ORF (NP_001013011.1, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C9orf152 (Chromosome 9 Open Reading Frame 152) is a Protein Coding gene.
Molecular Mass : 50.3 kDa
AA Sequence : MAEGSRTQAPGKGPPLSIQFLRAQYEGLKRQQRTQAHLLVLPKGGNTPAPAESMVNAVWINKERRSSLSLEEADSEVEGRLEEAAQGCLQAPKSPWHTHLEMHCLVQTSPQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNLGLYGSA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C9orf152 chromosome 9 open reading frame 152 [ Homo sapiens ]
Official Symbol C9orf152
Synonyms C9ORF152; chromosome 9 open reading frame 152; uncharacterized protein C9orf152; bA470J20.2; MGC131682;
Gene ID 401546
mRNA Refseq NM_001012993
Protein Refseq NP_001013011
UniProt ID Q5JTZ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C9orf152 Products

Required fields are marked with *

My Review for All C9orf152 Products

Required fields are marked with *

0
cart-icon