Recombinant Full Length Human C9orf152 Protein, C-Flag-tagged

Cat.No. : C9orf152-1820HFL
Product Overview : Recombinant Full Length Human C9orf152 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : C9orf152 (Chromosome 9 Open Reading Frame 152) is a Protein Coding gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 26.1 kDa
AA Sequence : MEGLPCPCPALPHFWQLRSHLMAEGSRTQAPGKGPPLSIQFLRAQYEGLKRQQRTQAHLLVLPKGGNTPAPAESMVNAVWINKERRSSLSLEEADSEVEGRLEEAAQGCLQAPKSPWHTHLEMHCLVQTSPQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNLGLYGSATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name C9orf152 chromosome 9 open reading frame 152 [ Homo sapiens (human) ]
Official Symbol C9orf152
Synonyms bA470J20.2
Gene ID 401546
mRNA Refseq NM_001012993.3
Protein Refseq NP_001013011.2
UniProt ID Q5JTZ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C9orf152 Products

Required fields are marked with *

My Review for All C9orf152 Products

Required fields are marked with *

0
cart-icon
0
compare icon