Recombinant Full Length Human C9orf152 Protein, C-Flag-tagged
Cat.No. : | C9orf152-1820HFL |
Product Overview : | Recombinant Full Length Human C9orf152 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | C9orf152 (Chromosome 9 Open Reading Frame 152) is a Protein Coding gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | MEGLPCPCPALPHFWQLRSHLMAEGSRTQAPGKGPPLSIQFLRAQYEGLKRQQRTQAHLLVLPKGGNTPAPAESMVNAVWINKERRSSLSLEEADSEVEGRLEEAAQGCLQAPKSPWHTHLEMHCLVQTSPQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNLGLYGSATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | C9orf152 chromosome 9 open reading frame 152 [ Homo sapiens (human) ] |
Official Symbol | C9orf152 |
Synonyms | bA470J20.2 |
Gene ID | 401546 |
mRNA Refseq | NM_001012993.3 |
Protein Refseq | NP_001013011.2 |
UniProt ID | Q5JTZ5 |
◆ Recombinant Proteins | ||
C9orf152-1820HFL | Recombinant Full Length Human C9orf152 Protein, C-Flag-tagged | +Inquiry |
C9orf152-477H | Recombinant Human C9orf152 Protein, His (Fc)-Avi-tagged | +Inquiry |
C9orf152-2687HF | Recombinant Full Length Human C9orf152 Protein, GST-tagged | +Inquiry |
C9orf152-0188H | Recombinant Human C9orf152 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C9orf152-7941HCL | Recombinant Human C9orf152 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C9orf152 Products
Required fields are marked with *
My Review for All C9orf152 Products
Required fields are marked with *