Recombinant Full Length Human C9orf152 Protein, C-Flag-tagged

• Cat.No.: C9orf152-1820HFL
• Product Overview: Recombinant Full Length Human C9orf152 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: C9orf152 (Chromosome 9 Open Reading Frame 152) is a Protein Coding gene.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 26.1 kDa
• AA Sequence: MEGLPCPCPALPHFWQLRSHLMAEGSRTQAPGKGPPLSIQFLRAQYEGLKRQQRTQAHLLVLPKGGNTPAPAESMVNAVWINKERRSSLSLEEADSEVEGRLEEAAQGCLQAPKSPWHTHLEMHCLVQTSPQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNLGLYGSATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: C9orf152 chromosome 9 open reading frame 152 [ Homo sapiens (human) ]
• Official Symbol: C9orf152
• Synonyms: bA470J20.2
• Gene ID: 401546
• mRNA Refseq: NM_001012993.3
• Protein Refseq: NP_001013011.2
• UniProt ID: Q5JTZ5