Recombinant Full Length Human C9orf169 Protein, GST-tagged
Cat.No. : | C9orf169-6438HF |
Product Overview : | Human MGC59937 full-length ORF ( NP_945352.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 144 amino acids |
Description : | CYSRT1 (Cysteine Rich Tail 1) is a Protein Coding gene. |
Molecular Mass : | 41.7 kDa |
AA Sequence : | MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPVGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C9orf169 chromosome 9 open reading frame 169 [ Homo sapiens ] |
Official Symbol | C9orf169 |
Synonyms | C9orf169; chromosome 9 open reading frame 169 |
Gene ID | 375791 |
mRNA Refseq | NM_199001 |
Protein Refseq | NP_945352 |
UniProt ID | A8MQ03 |
◆ Recombinant Proteins | ||
C9orf169-5297H | Recombinant Human C9orf169 Protein, GST-tagged | +Inquiry |
C9orf169-6438HF | Recombinant Full Length Human C9orf169 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C9orf169-7938HCL | Recombinant Human C9orf169 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C9orf169 Products
Required fields are marked with *
My Review for All C9orf169 Products
Required fields are marked with *