Recombinant Full Length Human C9orf57 Protein
| Cat.No. : | C9orf57-2717HF |
| Product Overview : | Human C9orf57 full-length ORF (ADR83461.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 298 amino acids |
| Description : | C9orf57 (Chromosome 9 Open Reading Frame 57) is a Protein Coding gene. |
| Form : | Liquid |
| Molecular Mass : | 14 kDa |
| AA Sequence : | MGVGFTELEYLAPWLRPPFSDLGTCQTKPGQYWKEEVHIQDVGGLICRACNLSLPFHGCLLDLGTCQAEPGQYCKEEVHIQGGIQWYSVKGCTKNTSECFKSTLVKRILQLHELVTTHCCNHSLCNF |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | C9orf57 chromosome 9 open reading frame 57 [ Homo sapiens ] |
| Official Symbol | C9orf57 |
| Synonyms | RP11-346E17.3 |
| Gene ID | 138240 |
| mRNA Refseq | NM_001128618 |
| Protein Refseq | NP_001122090 |
| UniProt ID | Q5W0N0 |
| ◆ Recombinant Proteins | ||
| RFL21496HF | Recombinant Full Length Human Uncharacterized Protein C9Orf57(C9Orf57) Protein, His-Tagged | +Inquiry |
| C9orf57-2717HF | Recombinant Full Length Human C9orf57 Protein | +Inquiry |
| C9orf57-0206H | Recombinant Human C9orf57 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C9orf57 Products
Required fields are marked with *
My Review for All C9orf57 Products
Required fields are marked with *
Recently Viewed
