Recombinant Human C9orf57 Protein

Cat.No. : C9orf57-0206H
Product Overview : Human C9orf57 full-length ORF (ADR83461.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : C9orf57 (Chromosome 9 Open Reading Frame 57) is a Protein Coding gene.
Form : Liquid
Molecular Mass : 14 kDa
AA Sequence : MGVGFTELEYLAPWLRPPFSDLGTCQTKPGQYWKEEVHIQDVGGLICRACNLSLPFHGCLLDLGTCQAEPGQYCKEEVHIQGGIQWYSVKGCTKNTSECFKSTLVKRILQLHELVTTHCCNHSLCNF
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name C9orf57 chromosome 9 open reading frame 57 [ Homo sapiens ]
Official Symbol C9orf57
Synonyms RP11-346E17.3
Gene ID 138240
mRNA Refseq NM_001128618
Protein Refseq NP_001122090
UniProt ID Q5W0N0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C9orf57 Products

Required fields are marked with *

My Review for All C9orf57 Products

Required fields are marked with *

0
cart-icon
0
compare icon