Recombinant Full Length Human CA9 Protein, C-Flag-tagged
Cat.No. : | CA9-1712HFL |
Product Overview : | Recombinant Full Length Human CA9 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IX is a transmembrane protein and is one of only two tumor-associated carbonic anhydrase isoenzymes known. It is expressed in all clear-cell renal cell carcinoma, but is not detected in normal kidney or most other normal tissues. It may be involved in cell proliferation and transformation. This gene was mapped to 17q21.2 by fluorescence in situ hybridization, however, radiation hybrid mapping localized it to 9p13-p12. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 45.8 kDa |
AA Sequence : | MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLMPVHPQRLPRMQEDSPLGGGSSGEDDPLGEEDLPSEED SPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSH WRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPLELLGFQLPPLPELRLRNNGHSVQLTLPPGL EMALGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLE EGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVM LSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCLAAGDILALVF GLLFAVTSVAFLVQMRRQHRRGTKGGVSYRPAEVAETGATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Nitrogen metabolism |
Full Length : | Full L. |
Gene Name | CA9 carbonic anhydrase 9 [ Homo sapiens (human) ] |
Official Symbol | CA9 |
Synonyms | MN; CAIX |
Gene ID | 768 |
mRNA Refseq | NM_001216.3 |
Protein Refseq | NP_001207.2 |
MIM | 603179 |
UniProt ID | Q16790 |
◆ Recombinant Proteins | ||
CA9-481H | Recombinant Human CA9 Protein, His (Fc)-Avi-tagged | +Inquiry |
CA9-1544CAF488 | Active Recombinant Canine CA9 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CA9-1712HFL | Recombinant Full Length Human CA9 Protein, C-Flag-tagged | +Inquiry |
CA9-890HP | Recombinant Human CA9 protein, Fc-tagged, R-PE labeled | +Inquiry |
CA9-790H | Recombinant Human CA9 protein, His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA9-3065HCL | Recombinant Human CA9 cell lysate | +Inquiry |
CA9-1447CCL | Recombinant Canine CA9 cell lysate | +Inquiry |
CA9-2189MCL | Recombinant Mouse CA9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA9 Products
Required fields are marked with *
My Review for All CA9 Products
Required fields are marked with *
0
Inquiry Basket