Recombinant Full Length Human CABLES1 Protein, GST-tagged
Cat.No. : | CABLES1-2762HF |
Product Overview : | Human CABLES1 full-length ORF (NP_612384.1, 1 a.a. - 368 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 368 amino acids |
Description : | This gene encodes a protein involved in regulation of the cell cycle through interactions with several cyclin-dependent kinases. One study (PMID: 16177568) reported aberrant splicing of transcripts from this gene which results in removal of the cyclin binding domain only in human cancer cells, and reduction in gene expression was shown in colorectal cancers (PMID: 17982127).Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012] |
Molecular Mass : | 68.3 kDa |
AA Sequence : | MLSKRGCHARIYADFPIRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTRNGRIVLISGRRSFCSIFSVLPYRDSTQVGDLKLDGGRQSTGAVSLKEIIGLEGVELGADGKTVSYTQFLLPTNAFGARRNTIDSTSSFSQFRNLSHRSLSIGRASGTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGKHKRVLIFPSYMTTVIDYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGACVLLAAKIGSDLKKHEVKHLIDKLEEKFRLNRRELIAFEFPVLVALEFALHLPEHEVMPHYRRLVQSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CABLES1 Cdk5 and Abl enzyme substrate 1 [ Homo sapiens ] |
Official Symbol | CABLES1 |
Synonyms | CABLES1; Cdk5 and Abl enzyme substrate 1; CDK5 and ABL1 enzyme substrate 1; FLJ35924; HsT2563; interactor with CDK3 1; CABL1; IK3-1; CABLES; |
Gene ID | 91768 |
mRNA Refseq | NM_001100619 |
Protein Refseq | NP_001094089 |
MIM | 609194 |
UniProt ID | Q8TDN4 |
◆ Recombinant Proteins | ||
CABLES1-0256H | Recombinant Human CABLES1 Protein, GST-Tagged | +Inquiry |
CABLES1-2263H | Recombinant Human CABLES1 Protein, His-tagged | +Inquiry |
CABLES1-1361H | Active Recombinant Human ABL1, GST-tagged | +Inquiry |
CABLES1-6024Z | Recombinant Zebrafish CABLES1 | +Inquiry |
CABLES1-2762HF | Recombinant Full Length Human CABLES1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CABLES1-267HCL | Recombinant Human CABLES1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CABLES1 Products
Required fields are marked with *
My Review for All CABLES1 Products
Required fields are marked with *
0
Inquiry Basket