Recombinant Full Length Human CABLES1 Protein, GST-tagged

Cat.No. : CABLES1-2762HF
Product Overview : Human CABLES1 full-length ORF (NP_612384.1, 1 a.a. - 368 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 368 amino acids
Description : This gene encodes a protein involved in regulation of the cell cycle through interactions with several cyclin-dependent kinases. One study (PMID: 16177568) reported aberrant splicing of transcripts from this gene which results in removal of the cyclin binding domain only in human cancer cells, and reduction in gene expression was shown in colorectal cancers (PMID: 17982127).Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
Molecular Mass : 68.3 kDa
AA Sequence : MLSKRGCHARIYADFPIRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTRNGRIVLISGRRSFCSIFSVLPYRDSTQVGDLKLDGGRQSTGAVSLKEIIGLEGVELGADGKTVSYTQFLLPTNAFGARRNTIDSTSSFSQFRNLSHRSLSIGRASGTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGKHKRVLIFPSYMTTVIDYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGACVLLAAKIGSDLKKHEVKHLIDKLEEKFRLNRRELIAFEFPVLVALEFALHLPEHEVMPHYRRLVQSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CABLES1 Cdk5 and Abl enzyme substrate 1 [ Homo sapiens ]
Official Symbol CABLES1
Synonyms CABLES1; Cdk5 and Abl enzyme substrate 1; CDK5 and ABL1 enzyme substrate 1; FLJ35924; HsT2563; interactor with CDK3 1; CABL1; IK3-1; CABLES;
Gene ID 91768
mRNA Refseq NM_001100619
Protein Refseq NP_001094089
MIM 609194
UniProt ID Q8TDN4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CABLES1 Products

Required fields are marked with *

My Review for All CABLES1 Products

Required fields are marked with *

0
cart-icon