Recombinant Full Length Human CABP5 Protein, GST-tagged
Cat.No. : | CABP5-2767HF |
Product Overview : | Human CABP5 full-length ORF (ADR82830.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 173 amino acids |
Description : | The product of this gene belongs to a subfamily of calcium binding proteins, which share similarity to calmodulin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Expression of this gene is retina-specific. The mouse homolog of this protein has been shown to express in the inner nuclear layer of the retina, suggested its role in neuronal functioning. The specific function of this gene is unknown. [provided by RefSeq, Oct 2009] |
Molecular Mass : | 19.1 kDa |
AA Sequence : | MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CABP5 calcium binding protein 5 [ Homo sapiens ] |
Official Symbol | CABP5 |
Synonyms | CABP5; calcium binding protein 5; CABP3, calcium binding protein 3; calcium-binding protein 5; CaBP3; calcium-binding protein 3; CABP3; |
Gene ID | 56344 |
mRNA Refseq | NM_019855 |
Protein Refseq | NP_062829 |
MIM | 607315 |
UniProt ID | Q9NP86 |
◆ Recombinant Proteins | ||
CABP5-2767HF | Recombinant Full Length Human CABP5 Protein, GST-tagged | +Inquiry |
CABP5-5552H | Recombinant Human CABP5 protein, His-tagged | +Inquiry |
CABP5-0260H | Recombinant Human CABP5 Protein, GST-Tagged | +Inquiry |
CABP5-581H | Recombinant Human CABP5 protein(Met1-Arg173), His-tagged | +Inquiry |
Cabp5-1925M | Recombinant Mouse Cabp5 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CABP5-7908HCL | Recombinant Human CABP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CABP5 Products
Required fields are marked with *
My Review for All CABP5 Products
Required fields are marked with *