Recombinant Human CABP5 Protein, GST-Tagged

Cat.No. : CABP5-0260H
Product Overview : Human CABP5 full-length ORF (ADR82830.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The product of this gene belongs to a subfamily of calcium binding proteins, which share similarity to calmodulin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Expression of this gene is retina-specific. The mouse homolog of this protein has been shown to express in the inner nuclear layer of the retina, suggested its role in neuronal functioning. The specific function of this gene is unknown. [provided by RefSeq, Oct 2009]
Molecular Mass : 19.1 kDa
AA Sequence : MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CABP5 calcium binding protein 5 [ Homo sapiens ]
Official Symbol CABP5
Synonyms CABP5; calcium binding protein 5; CABP3, calcium binding protein 3; calcium-binding protein 5; CaBP3; calcium-binding protein 3; CABP3;
Gene ID 56344
mRNA Refseq NM_019855
Protein Refseq NP_062829
MIM 607315
UniProt ID Q9NP86

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CABP5 Products

Required fields are marked with *

My Review for All CABP5 Products

Required fields are marked with *

0
cart-icon