Recombinant Full Length Human CADM1 Protein, C-Flag-tagged
Cat.No. : | CADM1-1524HFL |
Product Overview : | Recombinant Full Length Human CADM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables signaling receptor binding activity. Involved in several processes, including cell recognition; positive regulation of cytokine production; and susceptibility to natural killer cell mediated cytotoxicity. Located in plasma membrane. Implicated in breast carcinoma and prostate cancer. Biomarker of cervix uteri carcinoma in situ. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 48.3 kDa |
AA Sequence : | MASVVLPSGSQCAAAAAAAAPPGLRLRLLLLLFSAAALIPTGDGQNLFTKDVTVIEGEVATISCQVNKSD DSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITV LVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVH KEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTW VRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTTTTTTTT TTTILTIITDSRAGEEGSIRAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADA DTAIINAEGGQNNSEEKKEYFITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Cell adhesion molecules (CAMs) |
Full Length : | Full L. |
Gene Name | CADM1 cell adhesion molecule 1 [ Homo sapiens (human) ] |
Official Symbol | CADM1 |
Synonyms | BL2; ST17; IGSF4; NECL2; RA175; TSLC1; IGSF4A; Necl-2; SYNCAM; sgIGSF; sTSLC-1; synCAM1 |
Gene ID | 23705 |
mRNA Refseq | NM_014333.4 |
Protein Refseq | NP_055148.3 |
MIM | 605686 |
UniProt ID | Q9BY67 |
◆ Recombinant Proteins | ||
CADM1-428H | Recombinant Human CADM1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cadm1-10651m | Recombinant mouse Cadm1, GST-tagged | +Inquiry |
CADM1-484H | Recombinant Human CADM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CADM1-617H | Recombinant Human cell adhesion molecule 1, His-tagged | +Inquiry |
Cadm1-1931M | Recombinant Mouse Cadm1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CADM1-2527HCL | Recombinant Human CADM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CADM1 Products
Required fields are marked with *
My Review for All CADM1 Products
Required fields are marked with *
0
Inquiry Basket