Recombinant Full Length Human CALB1 Protein, C-Flag-tagged
Cat.No. : | CALB1-2030HFL |
Product Overview : | Recombinant Full Length Human CALB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. Originally described as a 27 kDa protein, it is now known to be a 28 kDa protein. It contains four active calcium-binding domains, and has two modified domains that are thought to have lost their calcium binding capability. This protein is thought to buffer entry of calcium upon stimulation of glutamate receptors. Depletion of this protein was noted in patients with Huntington disease. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.8 kDa |
AA Sequence : | MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDD GKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDD TKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENE LDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CALB1 calbindin 1 [ Homo sapiens (human) ] |
Official Symbol | CALB1 |
Synonyms | CALB; D-28K |
Gene ID | 793 |
mRNA Refseq | NM_004929.4 |
Protein Refseq | NP_004920.1 |
MIM | 114050 |
UniProt ID | P05937 |
◆ Recombinant Proteins | ||
CALB1-1085R | Recombinant Rat CALB1 Protein | +Inquiry |
Calb1-743M | Recombinant Mouse Calb1 Protein, MYC/DDK-tagged | +Inquiry |
CALB1-10656H | Recombinant Human CALB1, His-tagged | +Inquiry |
Calb1-251R | Recombinant Rat Calbindin 1 | +Inquiry |
CALB1-6363H | Recombinant Human CALB1 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALB1-7897HCL | Recombinant Human CALB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CALB1 Products
Required fields are marked with *
My Review for All CALB1 Products
Required fields are marked with *
0
Inquiry Basket