Recombinant Full Length Human CALB1 Protein, GST-tagged
Cat.No. : | CALB1-3045HF |
Product Overview : | Human CALB1 full-length ORF (NP_004920.1, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 261 amino acids |
Description : | The protein encoded by this gene is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. Originally described as a 27 kDa protein, it is now known to be a 28 kDa protein. It contains four active calcium-binding domains, and has two modified domains that are thought to have lost their calcium binding capability. This protein is thought to buffer entry of calcium upon stimulation of glutamate receptors. Depletion of this protein was noted in patients with Huntington disease. [provided by RefSeq, Jan 2015] |
Molecular Mass : | 56.4 kDa |
AA Sequence : | MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CALB1 calbindin 1, 28kDa [ Homo sapiens ] |
Official Symbol | CALB1 |
Synonyms | CALB1; calbindin 1, 28kDa; CALB; calbindin; D-28K; calbindin D28; RTVL-H protein; calbindin 1, (28kD); vitamin D-dependent calcium-binding protein, avian-type; |
Gene ID | 793 |
mRNA Refseq | NM_004929 |
Protein Refseq | NP_004920 |
MIM | 114050 |
UniProt ID | P05937 |
◆ Recombinant Proteins | ||
Calb1-251R | Recombinant Rat Calbindin 1 | +Inquiry |
Calb1-479M | Recombinant Mouse Calb1 Protein, His/GST-tagged | +Inquiry |
Calb1-480R | Recombinant Rat Calb1 Protein, His-tagged | +Inquiry |
CALB1-749R | Recombinant Rat CALB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CALB1-1393H | Recombinant Human Calbindin 1, 28kDa | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALB1-7897HCL | Recombinant Human CALB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALB1 Products
Required fields are marked with *
My Review for All CALB1 Products
Required fields are marked with *