Recombinant Full Length Human Calcium-Binding Mitochondrial Carrier Protein Scamc-3(Slc25A23) Protein, His-Tagged
Cat.No. : | RFL26394HF |
Product Overview : | Recombinant Full Length Human Calcium-binding mitochondrial carrier protein SCaMC-3(SLC25A23) Protein (Q9BV35) (1-468aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-468) |
Form : | Lyophilized powder |
AA Sequence : | MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDA DPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEK ILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSKQEK LTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGIRS LWRGNGINVLKIAPESAIKFMAYEQIKRAILGQQETLHVQERFVAGSLAGATAQTIIYPM EVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLK NWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQASIEGGPQLSMLG LLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC25A23 |
Synonyms | SLC25A23; APC2; MCSC2; SCAMC3; Calcium-binding mitochondrial carrier protein SCaMC-3; Mitochondrial ATP-Mg/Pi carrier protein 2; Mitochondrial Ca(2+-dependent solute carrier protein 2; Small calcium-binding mitochondrial carrier protein 3; Solute carrier |
UniProt ID | Q9BV35 |
◆ Recombinant Proteins | ||
RFL15716MF | Recombinant Full Length Mouse Calcium-Binding Mitochondrial Carrier Protein Scamc-3(Slc25A23) Protein, His-Tagged | +Inquiry |
SLC25A23-15309M | Recombinant Mouse SLC25A23 Protein | +Inquiry |
SLC25A23-8277M | Recombinant Mouse SLC25A23 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A23-4063R | Recombinant Rhesus Macaque SLC25A23 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A23-4247R | Recombinant Rhesus monkey SLC25A23 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A23-1623HCL | Recombinant Human SLC25A23 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC25A23 Products
Required fields are marked with *
My Review for All SLC25A23 Products
Required fields are marked with *
0
Inquiry Basket