Recombinant Full Length Human calcium binding protein 1 protein, His&T7 tagged
Cat.No. : | CABP1-1119H |
Product Overview : | Recombinant Full Length Human CABP1 protein (1-370aa) with N-His&T7 tag was expressed in E. coli. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 1-370aa |
Description : | Calcium binding proteins are an important component of calcium mediated cellular signal transduction. This gene encodes a protein that belongs to a subfamily of calcium binding proteins which share similarity to calmodulin. The protein encoded by this gene regulates the gating of voltage-gated calcium ion channels. This protein inhibits calcium-dependent inactivation and supports calcium-dependent facilitation of ion channels containing voltage-dependent L-type calcium channel subunit alpha-1C. This protein also regulates calcium-dependent activity of inositol 1, 4, 5-triphosphate receptors, P/Q-type voltage-gated calcium channels, and transient receptor potential channel TRPC5. This gene is predominantly expressed in retina and brain. Alternative splicing results in multiple transcript variants encoding disinct isoforms. |
Tag : | N-His&T7 |
Molecular Mass : | 22 kDa |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGFGNCVKYPLRNLSRKDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Lyophilized from 50mM Tris, 300mM NaCl, pH8.5, 5% Trehalose |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.49 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |
Gene Name | CABP1 calcium binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | CABP1 |
Synonyms | CABP1; calcium binding protein 1; CALBRAIN; HCALB_BR; calcium-binding protein 1; calcium binding protein 5; caldendrin |
Gene ID | 9478 |
mRNA Refseq | NM_031205 |
Protein Refseq | NP_112482 |
MIM | 605563 |
UniProt ID | Q9NZU7 |
◆ Recombinant Proteins | ||
CABP1-1165M | Recombinant Mouse CABP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CABP1-4916H | Recombinant Human CABP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CABP1-0258H | Recombinant Human CABP1 Protein, GST-Tagged | +Inquiry |
CABP1-2763HF | Recombinant Full Length Human CABP1 Protein, GST-tagged | +Inquiry |
CABP1-2264H | Recombinant Human CABP1 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CABP1 Products
Required fields are marked with *
My Review for All CABP1 Products
Required fields are marked with *