| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His&T7 |
| Protein Length : |
1-370aa |
| Description : |
Calcium binding proteins are an important component of calcium mediated cellular signal transduction. This gene encodes a protein that belongs to a subfamily of calcium binding proteins which share similarity to calmodulin. The protein encoded by this gene regulates the gating of voltage-gated calcium ion channels. This protein inhibits calcium-dependent inactivation and supports calcium-dependent facilitation of ion channels containing voltage-dependent L-type calcium channel subunit alpha-1C. This protein also regulates calcium-dependent activity of inositol 1, 4, 5-triphosphate receptors, P/Q-type voltage-gated calcium channels, and transient receptor potential channel TRPC5. This gene is predominantly expressed in retina and brain. Alternative splicing results in multiple transcript variants encoding disinct isoforms. |
| Tag : |
N-His&T7 |
| Molecular Mass : |
22 kDa |
| AA Sequence : |
MASMTGGQQMGRGHHHHHHENLYFQGGFGNCVKYPLRNLSRKDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR |
| Endotoxin : |
< 1 EU/μg by LAL |
| Purity : |
> 95% by SDS-PAGE |
| Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : |
Lyophilized from 50mM Tris, 300mM NaCl, pH8.5, 5% Trehalose |
| Reconstitution : |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.49 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |
