Recombinant Full Length Human CASP6 Protein, GST-tagged
Cat.No. : | CASP6-2929HF |
Product Overview : | Human CASP6 full-length ORF (AAH00305.1, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 293 amino acids |
Description : | This gene encodes a member of the cysteine-aspartic acid protease (caspase) family of enzymes. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic acid residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Oct 2015] |
Molecular Mass : | 58.63 kDa |
AA Sequence : | MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEKLLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CASP6 caspase 6, apoptosis-related cysteine peptidase [ Homo sapiens ] |
Official Symbol | CASP6 |
Synonyms | CASP6; caspase 6, apoptosis-related cysteine peptidase; caspase 6, apoptosis related cysteine protease; caspase-6; MCH2; apoptotic protease MCH-2; caspase 6, apoptosis-related cysteine protease; |
Gene ID | 839 |
mRNA Refseq | NM_001226 |
Protein Refseq | NP_001217 |
MIM | 601532 |
UniProt ID | P55212 |
◆ Recombinant Proteins | ||
CASP6-10735H | Recombinant Human CASP6 protein(59-222 aa), His-tagged | +Inquiry |
CASP6-0426H | Active Recombinant Human CASP6 Protein | +Inquiry |
CASP6-298H | Recombinant Human CASP6 Protein, His-tagged | +Inquiry |
CASP6-566B | Recombinant Bovine CASP6 Protein, His-tagged | +Inquiry |
CASP6-2754M | Recombinant Mouse CASP6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP6-7834HCL | Recombinant Human CASP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CASP6 Products
Required fields are marked with *
My Review for All CASP6 Products
Required fields are marked with *
0
Inquiry Basket