Recombinant Full Length Human CBLN4 Protein, GST-tagged
Cat.No. : | CBLN4-2772HF |
Product Overview : | Human CBLN4 full-length ORF (NP_542184.1, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 201 amino acids |
Description : | This gene encodes a member of a family of small secreted proteins containing C1Q domains. Members of this family are involved in regulation of neurexin signalling during synapse development. The mouse homolog of the protein encoded by this gene competes with netrin to bind to the deleted in colorectal cancer receptor. [provided by RefSeq, Aug 2012] |
Molecular Mass : | 48.2 kDa |
AA Sequence : | MGSGRRALSAVPAVLLVLTLPGLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLVGGWQYSTFSGFLVFPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CBLN4 cerebellin 4 precursor [ Homo sapiens ] |
Official Symbol | CBLN4 |
Synonyms | CBLN4; cerebellin 4 precursor; CBLNL1, cerebellin precursor like 1; cerebellin-4; dJ885A10.1; cerebellin precursor-like 1; cerebellin-like glycoprotein 1; CBLNL1; |
Gene ID | 140689 |
mRNA Refseq | NM_080617 |
Protein Refseq | NP_542184 |
MIM | 615029 |
UniProt ID | Q9NTU7 |
◆ Recombinant Proteins | ||
CBLN4-643R | Recombinant Rhesus monkey CBLN4 Protein, His-tagged | +Inquiry |
CBLN4-0466H | Recombinant Human CBLN4 Protein, GST-Tagged | +Inquiry |
CBLN4-471R | Recombinant Rhesus Macaque CBLN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CBLN4-6153Z | Recombinant Zebrafish CBLN4 | +Inquiry |
CBLN4-001H | Recombinant Human cerebellin 4 precursor Protein, His tagged | +Inquiry |
◆ Native Proteins | ||
CBLN4-07H | Recombinant Human CBLN4 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBLN4 Products
Required fields are marked with *
My Review for All CBLN4 Products
Required fields are marked with *
0
Inquiry Basket