Recombinant Full Length Human CBLN4 Protein, GST-tagged

Cat.No. : CBLN4-2772HF
Product Overview : Human CBLN4 full-length ORF (NP_542184.1, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 201 amino acids
Description : This gene encodes a member of a family of small secreted proteins containing C1Q domains. Members of this family are involved in regulation of neurexin signalling during synapse development. The mouse homolog of the protein encoded by this gene competes with netrin to bind to the deleted in colorectal cancer receptor. [provided by RefSeq, Aug 2012]
Molecular Mass : 48.2 kDa
AA Sequence : MGSGRRALSAVPAVLLVLTLPGLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLVGGWQYSTFSGFLVFPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CBLN4 cerebellin 4 precursor [ Homo sapiens ]
Official Symbol CBLN4
Synonyms CBLN4; cerebellin 4 precursor; CBLNL1, cerebellin precursor like 1; cerebellin-4; dJ885A10.1; cerebellin precursor-like 1; cerebellin-like glycoprotein 1; CBLNL1;
Gene ID 140689
mRNA Refseq NM_080617
Protein Refseq NP_542184
MIM 615029
UniProt ID Q9NTU7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CBLN4 Products

Required fields are marked with *

My Review for All CBLN4 Products

Required fields are marked with *

0
cart-icon