Recombinant Full Length Human CBS Protein, GST-tagged
Cat.No. : | CBS-2776HF |
Product Overview : | Human CBS full-length ORF (AAH11381.1, 1 a.a. - 551 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 551 amino acids |
Description : | The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. This gene is a major contributor to cellular hydrogen sulfide production. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 86.35 kDa |
AA Sequence : | MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CBS cystathionine-beta-synthase [ Homo sapiens ] |
Official Symbol | CBS |
Synonyms | CBS; cystathionine-beta-synthase; cystathionine beta-synthase; HIP4; beta-thionase; serine sulfhydrase; methylcysteine synthase; |
Gene ID | 875 |
mRNA Refseq | NM_000071 |
Protein Refseq | NP_000062 |
MIM | 613381 |
UniProt ID | P35520 |
◆ Recombinant Proteins | ||
CBS-1918M | Recombinant Mouse CBS Protein (2-561 aa), His-tagged | +Inquiry |
CBS-5626H | Recombinant Human CBS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cbs-827M | Recombinant Mouse Cbs Protein, MYC/DDK-tagged | +Inquiry |
CBS-819R | Recombinant Rat CBS Protein, His (Fc)-Avi-tagged | +Inquiry |
CBS-2644H | Recombinant Human CBS protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBS-7809HCL | Recombinant Human CBS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBS Products
Required fields are marked with *
My Review for All CBS Products
Required fields are marked with *