Recombinant Human CBS protein, His-SUMO-tagged
Cat.No. : | CBS-2644H |
Product Overview : | Recombinant Human CBS protein(P35520)(1-413aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-413aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 61.4 kDa |
AA Sequence : | MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CBS cystathionine-beta-synthase [ Homo sapiens ] |
Official Symbol | CBS |
Synonyms | CBS; cystathionine-beta-synthase; cystathionine beta-synthase; HIP4; beta-thionase; serine sulfhydrase; methylcysteine synthase; |
Gene ID | 875 |
mRNA Refseq | NM_000071 |
Protein Refseq | NP_000062 |
MIM | 613381 |
UniProt ID | P35520 |
◆ Recombinant Proteins | ||
Cbs-827M | Recombinant Mouse Cbs Protein, MYC/DDK-tagged | +Inquiry |
CBS-1191HFL | Recombinant Full Length Human CBS Protein, C-Flag-tagged | +Inquiry |
CBS-819R | Recombinant Rat CBS Protein, His (Fc)-Avi-tagged | +Inquiry |
CBS-514H | Recombinant Human CBS Protein, His (Fc)-Avi-tagged | +Inquiry |
CBS-27861TH | Recombinant Human CBS, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBS-7809HCL | Recombinant Human CBS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBS Products
Required fields are marked with *
My Review for All CBS Products
Required fields are marked with *