Recombinant Full Length Human CBX1 Protein, GST-tagged
Cat.No. : | CBX1-2778HF |
Product Overview : | Human CBX1 full-length ORF (NP_006798.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 185 amino acids |
Description : | This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 47.8 kDa |
AA Sequence : | MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CBX1 chromobox homolog 1 [ Homo sapiens ] |
Official Symbol | CBX1 |
Synonyms | CBX1; chromobox homolog 1; chromobox homolog 1 (Drosophila HP1 beta); chromobox protein homolog 1; CBX; HP1 beta homolog (Drosophila); HP1 BETA; HP1Hs beta; M31; MOD1; HP1 beta homolog; modifier 1 protein; heterochromatin protein 1-beta; heterochromatin protein p25 beta; heterochromatin protein 1 homolog beta; chromobox homolog 1 (HP1 beta homolog Drosophila); p25beta; HP1-BETA; HP1Hsbeta; HP1Hs-beta; |
Gene ID | 10951 |
mRNA Refseq | NM_001127228 |
Protein Refseq | NP_001120700 |
MIM | 604511 |
UniProt ID | P83916 |
◆ Recombinant Proteins | ||
CBX1-1726HFL | Recombinant Full Length Human CBX1 Protein, C-Flag-tagged | +Inquiry |
CBX1-105H | Recombinant Human CBX1 Protein, Strep-tagged | +Inquiry |
CBX1-112C | Recombinant Cynomolgus Monkey CBX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CBX1-3580H | Recombinant Human CBX1, His-tagged | +Inquiry |
CBX1-0477H | Recombinant Human CBX1 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBX1-7807HCL | Recombinant Human CBX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CBX1 Products
Required fields are marked with *
My Review for All CBX1 Products
Required fields are marked with *
0
Inquiry Basket