Recombinant Full Length Human CBX2 Protein, GST-tagged

Cat.No. : CBX2-2779HF
Product Overview : Human CBX2 full-length ORF (ABZ92071.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 211 amino acids
Description : This gene encodes a component of the polycomb multiprotein complex, which is required to maintain the transcriptionally repressive state of many genes throughout development via chromatin remodeling and modification of histones. Disruption of this gene in mice results in male-to-female gonadal sex reversal. Mutations in this gene are also associated with gonadal dysgenesis in humans. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Mar 2010]
Molecular Mass : 23.3 kDa
AA Sequence : MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVGGRQREGLGPSGRGWHFCQQSVPLLGKQEPPFFLSLSFCCQGPQPAESSSPPLPGASCFSLSCTPLCWVAGSNCCRQALFPPRGSLGDGKEQEACVQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CBX2 chromobox homolog 2 (Pc class homolog, Drosophila) [ Homo sapiens ]
Official Symbol CBX2
Synonyms CBX2; chromobox homolog 2 (Pc class homolog, Drosophila); CDCA6, cell division cycle associated 6, chromobox homolog 2 (Drosophila Pc class); MGC10561; Pc class homolog (Drosophila); M33; CDCA6;
Gene ID 84733
mRNA Refseq NM_005189
Protein Refseq NP_005180
MIM 602770
UniProt ID Q14781

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CBX2 Products

Required fields are marked with *

My Review for All CBX2 Products

Required fields are marked with *

0
cart-icon
0
compare icon