Recombinant Full Length Human CCBE1 Protein, GST-tagged
| Cat.No. : | CCBE1-2791HF |
| Product Overview : | Human CCBE1 full-length ORF (AAH46645.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 215 amino acids |
| Description : | This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans. [provided by RefSeq, Mar 2010] |
| Molecular Mass : | 49 kDa |
| AA Sequence : | MVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCBE1 collagen and calcium binding EGF domains 1 [ Homo sapiens ] |
| Official Symbol | CCBE1 |
| Synonyms | CCBE1; collagen and calcium binding EGF domains 1; collagen and calcium-binding EGF domain-containing protein 1; FLJ30681; KIAA1983; full of fluid protein homolog; MGC50861; |
| Gene ID | 147372 |
| mRNA Refseq | NM_133459 |
| Protein Refseq | NP_597716 |
| MIM | 612753 |
| UniProt ID | Q6UXH8 |
| ◆ Recombinant Proteins | ||
| CCBE1-10778H | Recombinant Human CCBE1, His-tagged | +Inquiry |
| CCBE1-2791HF | Recombinant Full Length Human CCBE1 Protein, GST-tagged | +Inquiry |
| CCBE1-2803M | Recombinant Mouse CCBE1 Protein | +Inquiry |
| CCBE1-0491H | Recombinant Human CCBE1 Protein, GST-Tagged | +Inquiry |
| CCBE1-1279M | Recombinant Mouse CCBE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCBE1-291HCL | Recombinant Human CCBE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCBE1 Products
Required fields are marked with *
My Review for All CCBE1 Products
Required fields are marked with *
