Recombinant Human CCBE1 Protein, GST-Tagged

• Cat.No.: CCBE1-0491H
• Product Overview: Human CCBE1 full-length ORF (AAH46645.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans. [provided by RefSeq, Mar 2010]
• Molecular Mass: 49 kDa
• AA Sequence: MVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCBE1 collagen and calcium binding EGF domains 1 [ Homo sapiens ]
• Official Symbol: CCBE1
• Synonyms: CCBE1; collagen and calcium binding EGF domains 1; collagen and calcium-binding EGF domain-containing protein 1; FLJ30681; KIAA1983; full of fluid protein homolog; MGC50861
• Gene ID: 147372
• mRNA Refseq: NM_133459
• Protein Refseq: NP_597716
• MIM: 612753
• UniProt ID: Q6UXH8