Recombinant Human CCBE1 Protein, GST-Tagged

Cat.No. : CCBE1-0491H
Product Overview : Human CCBE1 full-length ORF (AAH46645.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans. [provided by RefSeq, Mar 2010]
Molecular Mass : 49 kDa
AA Sequence : MVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCBE1 collagen and calcium binding EGF domains 1 [ Homo sapiens ]
Official Symbol CCBE1
Synonyms CCBE1; collagen and calcium binding EGF domains 1; collagen and calcium-binding EGF domain-containing protein 1; FLJ30681; KIAA1983; full of fluid protein homolog; MGC50861;
Gene ID 147372
mRNA Refseq NM_133459
Protein Refseq NP_597716
MIM 612753
UniProt ID Q6UXH8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCBE1 Products

Required fields are marked with *

My Review for All CCBE1 Products

Required fields are marked with *

0
cart-icon
0
compare icon