Recombinant Full Length Human CCDC106 Protein, GST-tagged

• Cat.No.: CCDC106-2815HF
• Product Overview: Human CCDC106 full-length ORF (NP_037433.2, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 280 amino acids
• Description: CCDC106 (Coiled-Coil Domain Containing 106) is a Protein Coding gene.
• Molecular Mass: 58.4 kDa
• AA Sequence: MNDRSSRRRTMKDDETFEISIPFDEAPHLDPQIFYSLSPSRRNFEEPPEAASSALALMNSVKTQLHMALERNSWLQKRIEDLEEERDFLRCQLDKFISSARMEAEDHCRMKPGPRRMEGDSRGGAGGEASDPESAASSLSGASEEGSASERRRQKQKGGASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC106 coiled-coil domain containing 106 [ Homo sapiens ]
• Official Symbol: CCDC106
• Synonyms: CCDC106; coiled-coil domain containing 106; coiled-coil domain-containing protein 106; HSU79303; protein predicted by clone 23882; ZNF581
• Gene ID: 29903
• mRNA Refseq: NM_013301
• Protein Refseq: NP_037433
• MIM: 613478
• UniProt ID: Q9BWC9