Recombinant Full Length Human CCDC106 Protein, GST-tagged
Cat.No. : | CCDC106-2815HF |
Product Overview : | Human CCDC106 full-length ORF (NP_037433.2, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 280 amino acids |
Description : | CCDC106 (Coiled-Coil Domain Containing 106) is a Protein Coding gene. |
Molecular Mass : | 58.4 kDa |
AA Sequence : | MNDRSSRRRTMKDDETFEISIPFDEAPHLDPQIFYSLSPSRRNFEEPPEAASSALALMNSVKTQLHMALERNSWLQKRIEDLEEERDFLRCQLDKFISSARMEAEDHCRMKPGPRRMEGDSRGGAGGEASDPESAASSLSGASEEGSASERRRQKQKGGASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC106 coiled-coil domain containing 106 [ Homo sapiens ] |
Official Symbol | CCDC106 |
Synonyms | CCDC106; coiled-coil domain containing 106; coiled-coil domain-containing protein 106; HSU79303; protein predicted by clone 23882; ZNF581; |
Gene ID | 29903 |
mRNA Refseq | NM_013301 |
Protein Refseq | NP_037433 |
MIM | 613478 |
UniProt ID | Q9BWC9 |
◆ Recombinant Proteins | ||
CCDC106-654R | Recombinant Rhesus monkey CCDC106 Protein, His-tagged | +Inquiry |
CCDC106-1284M | Recombinant Mouse CCDC106 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC106-276H | Recombinant Human CCDC106 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCDC106-0505H | Recombinant Human CCDC106 Protein, GST-Tagged | +Inquiry |
CCDC106-2810M | Recombinant Mouse CCDC106 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC106-7791HCL | Recombinant Human CCDC106 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC106 Products
Required fields are marked with *
My Review for All CCDC106 Products
Required fields are marked with *
0
Inquiry Basket