Recombinant Full Length Human CCDC121 Protein, GST-tagged

Cat.No. : CCDC121-3861HF
Product Overview : Human CCDC121 full-length ORF ( NP_078860.2, 1 a.a. - 278 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 278 amino acids
Description : CCDC121 (Coiled-Coil Domain Containing 121) is a Protein Coding gene.
Molecular Mass : 59.5 kDa
AA Sequence : MTDLNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSGEIERRRQESASRYAEQISVLKTALLQKENIQSSLKRKLQAMRDIAILKEKQEKEIQTLQEETKKVQAETASKTREVQAQLLQEKRLLEKQLSEPDRRLLGKRKRRELNMKAQALKLAAKRFIFEYSCGINRENQQFKKELLQLIEQAQKLTATQSHLENRKQQLQQEQWYLESLIQARQRLQGSHNQCLNRQDVPKTTPSLPQGTKSRINPK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC121 coiled-coil domain containing 121 [ Homo sapiens (human) ]
Official Symbol CCDC121
Synonyms CCDC121; coiled-coil domain containing 121; coiled-coil domain-containing protein 121
Gene ID 79635
mRNA Refseq NM_001142683
Protein Refseq NP_001136155
UniProt ID Q6ZUS5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCDC121 Products

Required fields are marked with *

My Review for All CCDC121 Products

Required fields are marked with *

0
cart-icon
0
compare icon