Recombinant Human CCDC121 Protein, GST-tagged
Cat.No. : | CCDC121-5185H |
Product Overview : | Human CCDC121 full-length ORF ( NP_078860.2, 1 a.a. - 278 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CCDC121 (Coiled-Coil Domain Containing 121) is a Protein Coding gene. |
Molecular Mass : | 59.5 kDa |
AA Sequence : | MTDLNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSGEIERRRQESASRYAEQISVLKTALLQKENIQSSLKRKLQAMRDIAILKEKQEKEIQTLQEETKKVQAETASKTREVQAQLLQEKRLLEKQLSEPDRRLLGKRKRRELNMKAQALKLAAKRFIFEYSCGINRENQQFKKELLQLIEQAQKLTATQSHLENRKQQLQQEQWYLESLIQARQRLQGSHNQCLNRQDVPKTTPSLPQGTKSRINPK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC121 coiled-coil domain containing 121 [ Homo sapiens (human) ] |
Official Symbol | CCDC121 |
Synonyms | CCDC121; coiled-coil domain containing 121; coiled-coil domain-containing protein 121 |
Gene ID | 79635 |
mRNA Refseq | NM_001142683 |
Protein Refseq | NP_001136155 |
UniProt ID | Q6ZUS5 |
◆ Recombinant Proteins | ||
CCDC121-5185H | Recombinant Human CCDC121 Protein, GST-tagged | +Inquiry |
CCDC121-3861HF | Recombinant Full Length Human CCDC121 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC121-152HCL | Recombinant Human CCDC121 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC121 Products
Required fields are marked with *
My Review for All CCDC121 Products
Required fields are marked with *