Recombinant Full Length Human CCDC126 Protein, GST-tagged
Cat.No. : | CCDC126-2833HF |
Product Overview : | Human CCDC126 full-length ORF (NP_620126.2, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 140 amino acids |
Description : | CCDC126 (Coiled-Coil Domain Containing 126) is a Protein Coding gene. GO annotations related to this gene include alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity. An important paralog of this gene is MGAT5B. |
Molecular Mass : | 42.1 kDa |
AA Sequence : | MFFTISRKNMSQKLSLLLLVFGLIWGLMLLHYTFQQPRHQSSVKLREQILDLSKRYVKALAEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSIR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC126 coiled-coil domain containing 126 [ Homo sapiens ] |
Official Symbol | CCDC126 |
Synonyms | CCDC126; coiled-coil domain containing 126; coiled-coil domain-containing protein 126; FLJ23031; MGC104248; |
Gene ID | 90693 |
mRNA Refseq | NM_138771 |
Protein Refseq | NP_620126 |
UniProt ID | Q96EE4 |
◆ Recombinant Proteins | ||
CCDC126-4366Z | Recombinant Zebrafish CCDC126 | +Inquiry |
CCDC126-2831M | Recombinant Mouse CCDC126 Protein | +Inquiry |
CCDC126-2833HF | Recombinant Full Length Human CCDC126 Protein, GST-tagged | +Inquiry |
CCDC126-1301M | Recombinant Mouse CCDC126 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC126-0521H | Recombinant Human CCDC126 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC126-7783HCL | Recombinant Human CCDC126 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC126 Products
Required fields are marked with *
My Review for All CCDC126 Products
Required fields are marked with *