Recombinant Full Length Human CCDC126 Protein, GST-tagged

Cat.No. : CCDC126-2833HF
Product Overview : Human CCDC126 full-length ORF (NP_620126.2, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 140 amino acids
Description : CCDC126 (Coiled-Coil Domain Containing 126) is a Protein Coding gene. GO annotations related to this gene include alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity. An important paralog of this gene is MGAT5B.
Molecular Mass : 42.1 kDa
AA Sequence : MFFTISRKNMSQKLSLLLLVFGLIWGLMLLHYTFQQPRHQSSVKLREQILDLSKRYVKALAEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSIR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC126 coiled-coil domain containing 126 [ Homo sapiens ]
Official Symbol CCDC126
Synonyms CCDC126; coiled-coil domain containing 126; coiled-coil domain-containing protein 126; FLJ23031; MGC104248;
Gene ID 90693
mRNA Refseq NM_138771
Protein Refseq NP_620126
UniProt ID Q96EE4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCDC126 Products

Required fields are marked with *

My Review for All CCDC126 Products

Required fields are marked with *

0
cart-icon