Recombinant Full Length Human CCDC42 Protein, GST-tagged
| Cat.No. : | CCDC42-2862HF |
| Product Overview : | Human CCDC42 full-length ORF (AAH29224.1, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 242 amino acids |
| Description : | CCDC42 (Coiled-Coil Domain Containing 42) is a Protein Coding gene. An important paralog of this gene is CFAP73. |
| Molecular Mass : | 55.4 kDa |
| AA Sequence : | MSLGIMEEEDLAEYFRLQYGERLLQMLQKLPNVEGASESPSIWLLEKKKETEIMHQTMVQKKKMFQRRMETLNLRWEELGVKEAQLKAHIQKSEQFIQENDQKRIRAMKKANKERELKCQHMQELTKRKQEMVALRLEHQRLSAKLKDYYIFNKYLEKVVENSEESRWAHIQNTAAKKTLLLGTIKMATLNLFQIVSKHLKEVTEVALEDTHKQLDMIQQFIQDRSDIWAEVKKKEQQRVRI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCDC42 coiled-coil domain containing 42 [ Homo sapiens ] |
| Official Symbol | CCDC42 |
| Synonyms | CCDC42; coiled-coil domain containing 42; coiled-coil domain-containing protein 42A; CCDC42A; FLJ32734; |
| Gene ID | 146849 |
| mRNA Refseq | NM_001158261 |
| Protein Refseq | NP_001151733 |
| UniProt ID | Q96M95 |
| ◆ Recombinant Proteins | ||
| CCDC42-2862HF | Recombinant Full Length Human CCDC42 Protein, GST-tagged | +Inquiry |
| CCDC42-494R | Recombinant Rhesus Macaque CCDC42 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CCDC42-10800H | Recombinant Human CCDC42, His-tagged | +Inquiry |
| CCDC42-0550H | Recombinant Human CCDC42 Protein, GST-Tagged | +Inquiry |
| CCDC42-666R | Recombinant Rhesus monkey CCDC42 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCDC42-156HCL | Recombinant Human CCDC42 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC42 Products
Required fields are marked with *
My Review for All CCDC42 Products
Required fields are marked with *




