Recombinant Full Length Human CCDC42 Protein, GST-tagged
Cat.No. : | CCDC42-2862HF |
Product Overview : | Human CCDC42 full-length ORF (AAH29224.1, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 242 amino acids |
Description : | CCDC42 (Coiled-Coil Domain Containing 42) is a Protein Coding gene. An important paralog of this gene is CFAP73. |
Molecular Mass : | 55.4 kDa |
AA Sequence : | MSLGIMEEEDLAEYFRLQYGERLLQMLQKLPNVEGASESPSIWLLEKKKETEIMHQTMVQKKKMFQRRMETLNLRWEELGVKEAQLKAHIQKSEQFIQENDQKRIRAMKKANKERELKCQHMQELTKRKQEMVALRLEHQRLSAKLKDYYIFNKYLEKVVENSEESRWAHIQNTAAKKTLLLGTIKMATLNLFQIVSKHLKEVTEVALEDTHKQLDMIQQFIQDRSDIWAEVKKKEQQRVRI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC42 coiled-coil domain containing 42 [ Homo sapiens ] |
Official Symbol | CCDC42 |
Synonyms | CCDC42; coiled-coil domain containing 42; coiled-coil domain-containing protein 42A; CCDC42A; FLJ32734; |
Gene ID | 146849 |
mRNA Refseq | NM_001158261 |
Protein Refseq | NP_001151733 |
UniProt ID | Q96M95 |
◆ Recombinant Proteins | ||
CCDC42-10800H | Recombinant Human CCDC42, His-tagged | +Inquiry |
CCDC42-494R | Recombinant Rhesus Macaque CCDC42 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC42-666R | Recombinant Rhesus monkey CCDC42 Protein, His-tagged | +Inquiry |
CCDC42-2862HF | Recombinant Full Length Human CCDC42 Protein, GST-tagged | +Inquiry |
CCDC42-2894M | Recombinant Mouse CCDC42 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC42-156HCL | Recombinant Human CCDC42 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC42 Products
Required fields are marked with *
My Review for All CCDC42 Products
Required fields are marked with *