Recombinant Full Length Human CCDC42 Protein, GST-tagged

• Cat.No.: CCDC42-2862HF
• Product Overview: Human CCDC42 full-length ORF (AAH29224.1, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 242 amino acids
• Description: CCDC42 (Coiled-Coil Domain Containing 42) is a Protein Coding gene. An important paralog of this gene is CFAP73.
• Molecular Mass: 55.4 kDa
• AA Sequence: MSLGIMEEEDLAEYFRLQYGERLLQMLQKLPNVEGASESPSIWLLEKKKETEIMHQTMVQKKKMFQRRMETLNLRWEELGVKEAQLKAHIQKSEQFIQENDQKRIRAMKKANKERELKCQHMQELTKRKQEMVALRLEHQRLSAKLKDYYIFNKYLEKVVENSEESRWAHIQNTAAKKTLLLGTIKMATLNLFQIVSKHLKEVTEVALEDTHKQLDMIQQFIQDRSDIWAEVKKKEQQRVRI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC42 coiled-coil domain containing 42 [ Homo sapiens ]
• Official Symbol: CCDC42
• Synonyms: CCDC42; coiled-coil domain containing 42; coiled-coil domain-containing protein 42A; CCDC42A; FLJ32734
• Gene ID: 146849
• mRNA Refseq: NM_001158261
• Protein Refseq: NP_001151733
• UniProt ID: Q96M95