Recombinant Full Length Human CCDC68 Protein, GST-tagged

Cat.No. : CCDC68-2875HF
Product Overview : Human CCDC68 full-length ORF (NP_079490.1, 1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 335 amino acids
Description : CCDC68 (Coiled-Coil Domain Containing 68) is a Protein Coding gene. Diseases associated with CCDC68 include Cutaneous T Cell Lymphoma.
Molecular Mass : 65.3 kDa
AA Sequence : MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHCGNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMNKENEVLKIKLQASREAGAAALRNVAQRLFENYQTQSEEVRKKQEDSKQLLQVNKLEKEQKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKLSLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSVIQEMEGLKNNLKEQDKRIENLREKVNILEAQNKELKTQVALSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC68 coiled-coil domain containing 68 [ Homo sapiens ]
Official Symbol CCDC68
Synonyms CCDC68; coiled-coil domain containing 68; coiled-coil domain-containing protein 68; cutaneous T cell lymphoma associated antigen; SE57 1; CTCL tumor antigen se57-1; CTCL-associated antigen se57-1; cutaneous T-cell lymphoma associated antigen; cutaneous T-cell lymphoma-associated antigen se57-1; SE57-1; FLJ25368;
Gene ID 80323
mRNA Refseq NM_001143829
Protein Refseq NP_001137301
MIM 616909
UniProt ID Q9H2F9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCDC68 Products

Required fields are marked with *

My Review for All CCDC68 Products

Required fields are marked with *

0
cart-icon
0
compare icon