Recombinant Full Length Human CCDC74B Protein, GST-tagged
Cat.No. : | CCDC74B-3831HF |
Product Overview : | Human CCDC74B full-length ORF ( AAH67771.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 314 amino acids |
Description : | CCDC74B (Coiled-Coil Domain Containing 74B) is a Protein Coding gene. An important paralog of this gene is CCDC74A. |
Molecular Mass : | 61.5 kDa |
AA Sequence : | MSGAGVAAGTRPPSSPTPGSRRRRQRPSVGVQSLRPQSPQLRQSDPQKRNLDLEKSLQFLQQQHSEMLAKLHEEIEHLKRENKDLRYKLIMNQTSQKKDSLSTSSFQSVKSISNSGKARPQPGSFNKQDSKADVPQKADLEEEPLLHNSKLDKVPGVQGQARKEKAEASNAGAACMGNSQHQGRQMGAAAHPPMILPLPLRKPTTLRQCEVLIRELWNTNLLQTQELQHLKSLLEGSQRPQAVPEEASFPRDQEATHFPKVSTKSLSKKCLLLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRLHRSVL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC74B coiled-coil domain containing 74B [ Homo sapiens (human) ] |
Official Symbol | CCDC74B |
Synonyms | CCDC74B; coiled-coil domain containing 74B; coiled-coil domain-containing protein 74B |
Gene ID | 91409 |
mRNA Refseq | NM_001258307 |
Protein Refseq | NP_001245236 |
UniProt ID | Q96LY2 |
◆ Recombinant Proteins | ||
CCDC74B-8378Z | Recombinant Zebrafish CCDC74B | +Inquiry |
CCDC74B-5205H | Recombinant Human CCDC74B Protein, GST-tagged | +Inquiry |
CCDC74B-3831HF | Recombinant Full Length Human CCDC74B Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC74B Products
Required fields are marked with *
My Review for All CCDC74B Products
Required fields are marked with *