Recombinant Full Length Human CCDC74B Protein, GST-tagged

• Cat.No.: CCDC74B-3831HF
• Product Overview: Human CCDC74B full-length ORF ( AAH67771.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 314 amino acids
• Description: CCDC74B (Coiled-Coil Domain Containing 74B) is a Protein Coding gene. An important paralog of this gene is CCDC74A.
• Molecular Mass: 61.5 kDa
• AA Sequence: MSGAGVAAGTRPPSSPTPGSRRRRQRPSVGVQSLRPQSPQLRQSDPQKRNLDLEKSLQFLQQQHSEMLAKLHEEIEHLKRENKDLRYKLIMNQTSQKKDSLSTSSFQSVKSISNSGKARPQPGSFNKQDSKADVPQKADLEEEPLLHNSKLDKVPGVQGQARKEKAEASNAGAACMGNSQHQGRQMGAAAHPPMILPLPLRKPTTLRQCEVLIRELWNTNLLQTQELQHLKSLLEGSQRPQAVPEEASFPRDQEATHFPKVSTKSLSKKCLLLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRLHRSVL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC74B coiled-coil domain containing 74B [ Homo sapiens (human) ]
• Official Symbol: CCDC74B
• Synonyms: CCDC74B; coiled-coil domain containing 74B; coiled-coil domain-containing protein 74B
• Gene ID: 91409
• mRNA Refseq: NM_001258307
• Protein Refseq: NP_001245236
• UniProt ID: Q96LY2