Recombinant Full Length Human CCDC74B Protein, GST-tagged

Cat.No. : CCDC74B-3831HF
Product Overview : Human CCDC74B full-length ORF ( AAH67771.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 314 amino acids
Description : CCDC74B (Coiled-Coil Domain Containing 74B) is a Protein Coding gene. An important paralog of this gene is CCDC74A.
Molecular Mass : 61.5 kDa
AA Sequence : MSGAGVAAGTRPPSSPTPGSRRRRQRPSVGVQSLRPQSPQLRQSDPQKRNLDLEKSLQFLQQQHSEMLAKLHEEIEHLKRENKDLRYKLIMNQTSQKKDSLSTSSFQSVKSISNSGKARPQPGSFNKQDSKADVPQKADLEEEPLLHNSKLDKVPGVQGQARKEKAEASNAGAACMGNSQHQGRQMGAAAHPPMILPLPLRKPTTLRQCEVLIRELWNTNLLQTQELQHLKSLLEGSQRPQAVPEEASFPRDQEATHFPKVSTKSLSKKCLLLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRLHRSVL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC74B coiled-coil domain containing 74B [ Homo sapiens (human) ]
Official Symbol CCDC74B
Synonyms CCDC74B; coiled-coil domain containing 74B; coiled-coil domain-containing protein 74B
Gene ID 91409
mRNA Refseq NM_001258307
Protein Refseq NP_001245236
UniProt ID Q96LY2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCDC74B Products

Required fields are marked with *

My Review for All CCDC74B Products

Required fields are marked with *

0
cart-icon